PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_4AL_7C4C68FD0.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family NF-YA
Protein Properties Length: 269aa    MW: 28999.3 Da    PI: 9.8198
Description NF-YA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_4AL_7C4C68FD0.2genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CBFB_NFYA102.53.8e-32174230158
              CBFB_NFYA   1 deplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58 
                            +ep+YVNaKQy++Il+RRq+Rak+e e+k  +k+rkpylheSRh+hA+rR+Rg+gGrF
  Traes_4AL_7C4C68FD0.2 174 EEPVYVNAKQYHGILRRRQSRAKAELERKA-IKARKPYLHESRHQHAMRRARGTGGRF 230
                            69***************************9.**************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005217.2E-36172233IPR001289Nuclear transcription factor Y subunit A
PROSITE profilePS5115238.039173233IPR001289Nuclear transcription factor Y subunit A
PfamPF020452.3E-27175230IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006167.7E-25176198IPR001289Nuclear transcription factor Y subunit A
PROSITE patternPS006860178198IPR018362CCAAT-binding factor, conserved site
PRINTSPR006167.7E-25207230IPR001289Nuclear transcription factor Y subunit A
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0016602Cellular ComponentCCAAT-binding factor complex
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 269 aa     Download sequence    Send to blast
MSGMGSRPGE SNLVEPRGLP SGMAMQPWWT GTGFGAVSPA VVAPGSGAGI SLSSNPLGGG  60
AGKGATTQGK KKTADDDPRA QSSDDDSQRS GEPKDGSFEE ENQRATSRMP ALATDYLAPY  120
SHLELNQPMA SATYPYPDAY YTGMVGPYGA QAVAHFQLPG LTHPRMPLPL EVSEEPVYVN  180
AKQYHGILRR RQSRAKAELE RKAIKARKPY LHESRHQHAM RRARGTGGRF LNTKKDENGA  240
SNGGRTEANK GEQSSDYLRV PPDLHLRQA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4awl_A2e-20174238266NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3541160.0AK354116.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv1005C04.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003560983.11e-153PREDICTED: nuclear transcription factor Y subunit A-4-like
RefseqXP_010231280.11e-153PREDICTED: nuclear transcription factor Y subunit A-4-like
RefseqXP_014752975.11e-153PREDICTED: nuclear transcription factor Y subunit A-4-like
RefseqXP_014752976.11e-153PREDICTED: nuclear transcription factor Y subunit A-4-like
TrEMBLW5DQM50.0W5DQM5_WHEAT; Uncharacterized protein
STRINGBRADI1G11800.11e-152(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP82053649
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G30500.27e-42nuclear factor Y, subunit A7
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]